RHBDF1 Rabbit Polyclonal Antibody

• Catalog Number: orb580834
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RHBDF1
• Target: RHBDF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDF1
• Protein Sequence: Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR
• UniProt ID: Q96CC6
• MW: 97 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Dist1, hDist1, C16orf8, EGFR-RS, gene-89, gene-90
• Note: For research use only
• NCBI: NP_071895

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms present from ~95 kDa to ~80 kda and another isoform is present ~54 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

Positive control (+): Human stomach (ST), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-RHBDF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.