You have no items in your shopping cart.
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Application Notes |
Key Properties
−| Protein Sequence | Synthetic peptide located within the following region: EKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEI |
|---|
Storage & Handling
−| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
WB
Western Blot (IB, immunoblot)