Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EEF1A2 Rabbit Polyclonal Antibody

SKU: orb580330

Description

EEF1A2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EEF1A2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human EEF1A2. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Research, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EEF1A2
TargetEEF1A2
Protein SequenceSynthetic peptide located within the following region: VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP
Molecular Weight50 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HS1, STN, EF1A, STNL, DEE33, MRD38, EEF1AL, EIEE33, EF-1-alpha-2

Similar Products

  • EEF1A1/ EEF1A2 Antibody (N-term) [orb1929955]

    FC,  IHC-P,  WB

    C. elegans, Drosophila, Equine, Hamster, Mouse, Other, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • EF-1 α1/2 (Acetyl Lys41) rabbit pAb Antibody [orb763978]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • EEF1A2 Rabbit Polyclonal Antibody [orb626620]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • eEF1A2 binding protein Rabbit pAb Antibody [orb763723]

    IHC,  WB

    Human, Mouse, Porcine, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • eEF1A2 binding protein Rabbit pAb Antibody [orb763768]

    IHC,  WB

    Human, Mouse, Porcine, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

EEF1A2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation, acteylation, phosphorylation and/or lipidation.

EEF1A2 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.

EEF1A2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

EEF1A2 Rabbit Polyclonal Antibody

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml.

EEF1A2 Rabbit Polyclonal Antibody

WB Suggested Anti-EEF1A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain.

EEF1A2 Rabbit Polyclonal Antibody

WB Suggested Anti-EEF1A2 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001949

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

EEF1A2 Rabbit Polyclonal Antibody (orb580330)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry