EEF1A2 Rabbit Polyclonal Antibody

• Catalog Number: orb580330
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EEF1A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EEF1A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50 kDa
• Target: EEF1A2
• UniProt ID: Q05639
• Protein Sequence: Synthetic peptide located within the following region: VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP
• NCBI: NP_001949
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HS1, STN, EF1A, STNL, DEE33, MRD38, EEF1AL, EIEE33
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation, acteylation, phosphorylation and/or lipidation.

Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml.

WB Suggested Anti-EEF1A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain.

WB Suggested Anti-EEF1A2 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.