You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329845 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EED |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EED |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50kDa |
Target | EED |
UniProt ID | O75530 |
Protein Sequence | Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC |
NCBI | NP_003788 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HEED antibody, anti WAIT1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Stomach, Antibody Dilution: 1.0 ug/mL.
Sample Type: Rat Brain lysate, Dilution: 1:500.
WB Suggested Anti-EED Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:2500, Positive Control: OVCAR-3 cell lysate, EED is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |