You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329845 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EED |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EED |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50kDa |
Target | EED |
UniProt ID | O75530 |
Protein Sequence | Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC |
NCBI | NP_003788 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HEED antibody, anti WAIT1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Liver tissue using EED antibody
Western blot analysis of human Fetal Lung tissue using EED antibody
Western blot analysis of human Fetal Heart tissue using EED antibody
Western blot analysis of OVCAR-3 cell lysate tissue using EED antibody
Immunofluorescense analysis of rat Brain lysate using EED antibody
Western blot analysis of human Fetal Stomach tissue using EED antibody
Western blot analysis of human Fetal Muscle tissue using EED antibody
ELISA, IF, WB | |
Bovine, Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating