Cart summary

You have no items in your shopping cart.

ECM2 Rabbit Polyclonal Antibody (HRP)

ECM2 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2091269

Select Product Size
SizePriceQuantity
100 μl$ 680.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Catalog Numberorb2091269
CategoryAntibodies
DescriptionECM2 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ECM2
Protein SequenceSynthetic peptide located within the following region: FGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLP
UniProt IDO94769
MW71kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesMGC126355, MGC126356
NoteFor research use only
NCBINP_001184225
Expiration Date12 months from date of receipt.
  • SPARCL1 Rabbit Polyclonal Antibody (HRP) [orb468787]

    IHC-Fr,  IHC-P,  WB

    Equine, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl