You have no items in your shopping cart.
Cart summary
Item 1 of 1
ECM2 Rabbit Polyclonal Antibody
Catalog Number: orb326550
| Catalog Number | orb326550 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ECM2 |
| Target | ECM2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ECM2 |
| Protein Sequence | Synthetic peptide located within the following region: FGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLP |
| UniProt ID | O94769 |
| MW | 71kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti MGC126355 antibody, anti MGC126356 antibody |
| Note | For research use only |
| NCBI | NP_001184225 |
WB Suggested Anti-ECM2 Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell.
- Item 1 of 2
- Item 1 of 2
SPARCL1 Rabbit Polyclonal Antibody [orb100127]
IF, IHC-Fr, IHC-P, WB
Equine, Human, Porcine, Rabbit
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl 
