DYRK3 Rabbit Polyclonal Antibody

• Catalog Number: orb573667
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DYRK3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Mouse
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66 kDa
• Target: DYRK3
• UniProt ID: O43781
• Protein Sequence: Synthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
• NCBI: NP_003573
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RED, REDK, DYRK5, hYAK3-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Sample Type: HeLa cells, Primary Antibody dilution: 1:50, Secondary Antibody: Gaot anti-rabbit-Alexa Fluor, Secondary Antibody dilution: 1:250, Color/Signal Descriptions: Green: DYRK3 Red: PABP1 Blue: DAPI, Gene Name: DYRK3.

WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.