DYRK3 Rabbit Polyclonal Antibody

SKU: orb573667

Description

Rabbit polyclonal antibody to DYRK3

Research Area

Cell Biology, Epigenetics & Chromatin, Signal Transduction

Images & Validation

• Tested Applications: IF, WB
• Reactivity: Human
• Predicted Reactivity: Mouse

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3
• Target: DYRK3
• Protein Sequence: Synthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
• Molecular Weight: 66 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RED, REDK, DYRK5, hYAK3-2

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Sample Type: HeLa cells, Primary Antibody dilution: 1:50, Secondary Antibody: Gaot anti-rabbit-Alexa Fluor, Secondary Antibody dilution: 1:250, Color/Signal Descriptions: Green: DYRK3 Red: PABP1 Blue: DAPI, Gene Name: DYRK3.

WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.

Quick Database Links

Gene Symbol

DYRK3

UniProt

O43781

RefSeq (Protein):NP_003573