Cart summary

You have no items in your shopping cart.

DSEL Rabbit Polyclonal Antibody

Catalog Number: orb635620

Select Product Size
SizePriceQuantity
100 μl$ 600.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb635620
CategoryAntibodies
DescriptionRabbit polyclonal antibody to DSEL
TargetDSEL
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PurificationAffinity purified
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DSEL
Protein SequenceSynthetic peptide located within the following region: MFAFSTFEESVSNYSEWAVFTDDIDQFKTQKVQDFRPNQKLKKSMLHPSL
UniProt IDQ8IZU8
MW133 kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesC18orf4, DE-epi2
Research AreaEpigenetics
NoteFor research use only
NCBINP_115536
Expiration Date12 months from date of receipt.
Images
DSEL Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell lysates, Antibody Dilution: 3 ug/ml.

Similar Products
Reviews

DSEL Rabbit Polyclonal Antibody (orb635620)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet