Cart summary

You have no items in your shopping cart.

DSEL Rabbit Polyclonal Antibody (FITC)

DSEL Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2112222

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112222
CategoryAntibodies
DescriptionDSEL Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Predicted ReactivityBovine, Canine, Human, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence AFSTFEESVSNYSEWAVFTDDIDQFKTQKVQDFRPNQKLKKSMLHPSLYF
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW139 kDa
UniProt IDQ8IZU8
Protein SequenceSynthetic peptide located within the following region: AFSTFEESVSNYSEWAVFTDDIDQFKTQKVQDFRPNQKLKKSMLHPSLYF
NCBINP_115536
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesC18orf4, DE-epi2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.