Dpf3 Rabbit Polyclonal Antibody

• Catalog Number: orb576896
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Dpf3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: Dpf3
• UniProt ID: P58269
• Protein Sequence: Synthetic peptide located within the following region: IHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCY
• NCBI: NP_478119
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CERD, CERD4, cer-d, BAF45C, C78788, cer-d4, Gm1887
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-Dpf3 Antibody, Catalog Number: orb576896, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear (not in cardiomyocytes but in fibrocytes in endomysium, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Dpf3 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Spleen.