You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588959 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DOLK |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DOLK |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 59 kDa |
Target | DOLK |
UniProt ID | Q9UPQ8 |
Protein Sequence | Synthetic peptide located within the following region: ACLVVLYQNAKRSSSESKKHQAPTIARKYFHLIVVATYIPGIIFDRPLLY |
NCBI | NP_055723.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DK, DK1, CDG1M, SEC59, TMEM15 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human MDA-MB-435s lysates, Antibody Dilution: 1 ug/ml.
WB | |
Bovine, Equine, Gallus, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Gallus, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Biotin |