You have no items in your shopping cart.
[Des-Asp10]Decorsin, Leech
SKU: orb2693140
Description
Images & Validation
−![[Des-Asp10]Decorsin, Leech](/images/quality_badge_proteins.png){kind=icon}
Key Properties
−| Molecular Weight | 4268.78 |
|---|---|
| Protein Sequence | APRLPQCQGDQEKCLCNKDECPPGQCRFPRGDADPYCE |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
[Des-Asp10]Decorsin, Leech (orb2693140)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days