You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584601 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DEFB4A |
Target | DEFB4A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DEFB4A |
Protein Sequence | Synthetic peptide located within the following region: LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL |
UniProt ID | O15263 |
MW | 4kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BD-2, SAP1, DEFB2, DEFB4, HBD-2, DEFB-2, DEFB102 |
Note | For research use only |
NCBI | NP_004933 |
WB Suggested Anti-DEFB4A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta.
IF, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |