DEFB119 Rabbit Polyclonal Antibody

• Catalog Number: orb586979
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DEFB119
• Target: DEFB119
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DEFB119
• Protein Sequence: Synthetic peptide located within the following region: LLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNC
• UniProt ID: Q8N690
• MW: 9kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DEFB20, DEFB-19, DEFB-20, DEFB120, ESC42-RELA, ESC
• Note: For research use only
• NCBI: NP_695021
• Expiration Date: 12 months from date of receipt.

Sample Type: Fetal Heart lysates, Antibody dilution: 1.0 ug/ml.