Cart summary

You have no items in your shopping cart.

DEFB119 Rabbit Polyclonal Antibody (FITC)

DEFB119 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088417

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088417
CategoryAntibodies
DescriptionDEFB119 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Equine, Guinea pig, Human, Porcine, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human DEFB119
Protein SequenceSynthetic peptide located within the following region: LLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNC
UniProt IDQ8N690
MW9kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesDEFB20, DEFB-19, DEFB-20, DEFB120, ESC42-RELA, ESC
Read more...
NoteFor research use only
NCBINP_695021
Expiration Date12 months from date of receipt.