You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330487 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Dag1 |
Target | Dag1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Protein Sequence | Synthetic peptide located within the following region: PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM |
UniProt ID | Q62165 |
MW | 97kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti D9Wsu13e antibody, anti DG antibody, anti Dp4 Read more... |
Note | For research use only |
NCBI | NP_034147 |
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.
Sample Tissue: Mouse Liver, Antibody Dilution: 3 ug/mL.
Sample Tissue: Mouse SP2/0 Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-Dag1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Mouse Heart.
IHC-P, WB | |
Porcine, Rabbit | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine, Equine, Gallus, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |