DAG1 Rabbit Polyclonal Antibody

• Catalog Number: orb325274
• Category: Antibodies
• Description: Rabbit polyclonal antibody to alpha-DAG1
• Target: DAG1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human alpha-DAG1
• Protein Sequence: Synthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT
• UniProt ID: Q14118
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti 156DAG antibody, anti A3a antibody, anti AGRN
• Note: For research use only
• NCBI: NP_004384

Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human stomach (ST), Negative control (-): 293T (2T), Antibody concentration: 0.5 ug/mL.

Rabbit Anti-alpha-DAG1 Antibody, Catalog Number: orb325274, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-Alpha-DAG1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Stomach.