Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

DAG1 Rabbit Polyclonal Antibody

SKU: orb325274

Description

DAG1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of DAG1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human alpha-DAG1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human alpha-DAG1
TargetDAG1
Protein SequenceSynthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT
Molecular Weight27kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti 156DAG antibody, anti A3a antibody, anti AGRNR antibody, anti DAG antibody, anti MDDGC7 antibody

Similar Products

  • DAG1 Antibody (C-term) [orb1936136]

    IHC-P,  WB

    Porcine, Rabbit

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Dag1 Rabbit Polyclonal Antibody [orb330487]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • DAG1 Rabbit Polyclonal Antibody [orb394993]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Alpha Dystroglycan Rabbit Polyclonal Antibody [orb4385]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Gallus, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • DAG1 rabbit pAb Antibody [orb771840]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

DAG1 Rabbit Polyclonal Antibody

Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/mL.

DAG1 Rabbit Polyclonal Antibody

Positive control (+): Human stomach (ST), Negative control (-): 293T (2T), Antibody concentration: 0.5 ug/mL.

DAG1 Rabbit Polyclonal Antibody

Rabbit Anti-alpha-DAG1 Antibody, Catalog Number: orb325274, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

DAG1 Rabbit Polyclonal Antibody

WB Suggested Anti-Alpha-DAG1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Stomach.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004384

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

DAG1 Rabbit Polyclonal Antibody (orb325274)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry