You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581491 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYP11A1 |
Target | CYP11A1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP11A1 |
Protein Sequence | Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW |
UniProt ID | P05108 |
MW | 60 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CYP11A, CYPXIA1, P450SCC |
Note | For research use only |
NCBI | NP_000772 |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
CYP11A1 antibody - middle region (orb581491) validated by WB using Hela cell lysate at 1 ug/ml. CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa.
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
Immunohistochemistry with HK2 cell lysate tissue.
Immunohistochemistry with HK2 cell lysate tissue.
Immunohistochemistry with HK2 cell lysate tissue.
Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CYP11A1 antibody (orb581491).
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Rat | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |