You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587534 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYBB |
Target | CYBB |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYBB |
Protein Sequence | Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV |
UniProt ID | P04839 |
MW | 65kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CGD, NOX2, IMD34, AMCBX2, GP91-1, GP91PHOX, p91-PH Read more... |
Note | For research use only |
NCBI | NP_000388 |
Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 1 ug/ml.
Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.
Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |