Cart summary

You have no items in your shopping cart.

CXCL12 Rabbit Polyclonal Antibody

SKU: orb333745

Description

Rabbit polyclonal antibody to SDF1

Research Area

Cell Biology, Immunology & Inflammation, Neuroscience, Pharmacology & Drug Discovery, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CXCL12
TargetCXCL12
Protein SequenceSynthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Molecular Weight11 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C-X-C motif chemokine 12 antibody, anti CXCL12 antibody, anti CXCL-12 antibody, anti CXCL 12 antibody, anti hIRH antibody, anti hSDF-1 antibody, anti Intercrine reduced in hepatomas antibody, anti IRH antibody, anti PBSF antibody, anti SCYB12 antibody, anti SDF 1 alpha antibody, anti SDF 1 antibody, anti SDF 1 beta antibody, anti SDF 1b antibody, anti SDF-1 antibody, anti SDF-1a antibody, anti SDF-1b antibody, anti SDF1 antibody, anti SDF1a antibody, anti SDF1b antibody, anti Stromal cell derived factor 1 antibody, anti TLSF a antibody, anti TLSF antibody, anti TLSF b antibody, anti TLSF-a antibody, anti TLSF-b antibody, anti TLSFa antibody, anti TLSFb antibody, anti TPAR1 antibody

Similar Products

  • CXCL12 Rabbit Polyclonal Antibody [orb443170]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CXCL12 Antibody [orb676418]

    ELISA,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • CXCL12 Rabbit Polyclonal Antibody [orb1319]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Gallus, Guinea pig, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CXCL12 Rabbit Polyclonal Antibody [orb214560]

    IF,  IHC,  WB

    Canine, Human

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • CXCL12 Rabbit Polyclonal Antibody [orb1289723]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CXCL12 Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

CXCL12 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

CXCL12 Rabbit Polyclonal Antibody

WB Suggested Anti-CXCL12 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000600

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CXCL12 Rabbit Polyclonal Antibody (orb333745)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry