You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333745 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SDF1 |
Target | CXCL12 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CXCL12 |
Protein Sequence | Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
UniProt ID | P48061 |
MW | 11 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti C-X-C motif chemokine 12 antibody, anti CXCL1 Read more... |
Note | For research use only |
NCBI | NP_000600 |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
WB Suggested Anti-CXCL12 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung.
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Canine, Gallus, Guinea pig, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |