Cul4b Rabbit Polyclonal Antibody

• Catalog Number: orb585205
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Cul4b
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 111kDa
• Target: Cul4b
• UniProt ID: A2A432
• Protein Sequence: Synthetic peptide located within the following region: IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYN
• NCBI: NP_001103612
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CUL-4B, AA409770, mKIAA0695, 2700050M05Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Cul4b Antibody, Positive Control: Lane 1: 50 ug 293T lysate, Lane 2: 50 ug hCUL4B transfected 293T lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody dilution: 1:10000.

WB Suggested Anti-Cul4b Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.