CSF2RA Peptide - C-terminal region

• Catalog Number: orb2007290
• Category: Proteins
• Description: CSF2RA Peptide - C-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: VLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIW
• UniProt ID: B4DW68
• MW: 31kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with CSF2RA Rabbit Polyclonal Antibody (orb585998). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CS
• Note: For research use only
• NCBI: NP_001155004
• Expiration Date: 6 months from date of receipt.