CRISP1 Rabbit Polyclonal Antibody

• Catalog Number: orb582134
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CRISP1
• Target: CRISP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: ARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSEST
• UniProt ID: P54107
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ARP, AEGL1, HUMARP, CRISP-1, HEL-S-57, HSCRISP1D,
• Research Area: Cell Biology, Disease Biomarkers, Immunology & Inf
• Note: For research use only
• NCBI: NP_001122

WB Suggested Anti-CRISP1 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell. CRISP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.