You have no items in your shopping cart.
Cart summary
Item 1 of 1
CRISP1 Rabbit Polyclonal Antibody
Catalog Number: orb582133
| Catalog Number | orb582133 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CRISP1 |
| Target | CRISP1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Goat, Porcine, Rabbit, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CRISP1 |
| Protein Sequence | Synthetic peptide located within the following region: LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW |
| UniProt ID | P54107 |
| MW | 27kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ARP, AEGL1, HUMARP, CRISP-1, HEL-S-57, HSCRISP1D, Read more... |
| Research Area | Molecular Biology, Signal Transduction |
| Note | For research use only |
| NCBI | NP_001122 |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
