You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582133 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CRISP1 |
Target | CRISP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Goat, Porcine, Rabbit, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CRISP1 |
Protein Sequence | Synthetic peptide located within the following region: LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW |
UniProt ID | P54107 |
MW | 27kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ARP, AEGL1, HUMARP, CRISP-1, HEL-S-57, HSCRISP1D, Read more... |
Note | For research use only |
NCBI | NP_001122 |
WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Human | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |