CREB3L1 Rabbit Polyclonal Antibody

• Catalog Number: orb575802
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CREB3L1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: CREB3L1
• UniProt ID: Q96CP0
• Protein Sequence: Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG
• NCBI: NP_443086
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OI16, OASIS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The peptide is present in both a 57 kDa and a 48 kDa isoform.

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Hela (HL), Negative control (-): MCF7 (N10), Antibody concentration: 2.5 ug/ml.

WB Suggested Anti-CREB3L1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.