CPT1A Rabbit Polyclonal Antibody

• Catalog Number: orb579286
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CPT1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPT1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 88 kDa
• Target: CPT1A
• UniProt ID: P50416
• Protein Sequence: Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN
• NCBI: NP_001027017
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CPT1, CPT1-L, L-CPT1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1 ug/ml.

Sample Type: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Lanes: 1. 45 ug capan1 cell lysate, 2. 45 ug HPAF cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: CPT1A.

Sample Type: Human Capan1 cells (Pancreatic cancer cell line), Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-AlexaFluor-488, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: CPT1A: Green DAPI: Blue, Gene Name: CPT1A.

WB Suggested Anti-CPT1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.