COL6A1 Rabbit Polyclonal Antibody

• Catalog Number: orb333719
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Collagen VI
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COL6A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 106kDa
• Target: COL6A1
• UniProt ID: P12109
• Protein Sequence: Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
• NCBI: NP_001839
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti COL6A1 antibody, anti Collagen alpha-1(VI) ch
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-COL6A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, There is BioGPS gene expression data showing that COL6A1 is expressed in 721_B.

WB Suggested Anti-COL6A1 Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: human LCL.