CNOT4 Rabbit Polyclonal Antibody

SKU: orb575026

Description

Rabbit polyclonal antibody to CNOT4

Research Area

Epigenetics & Chromatin, Molecular Biology, Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNOT4
• Target: CNOT4
• Protein Sequence: Synthetic peptide located within the following region: QICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQK
• Molecular Weight: 63kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NOT4, NOT4H, CLONE243

WB Suggested Anti-CNOT4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, CNOT4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Quick Database Links

Gene Symbol

CNOT4

UniProt

O95628

RefSeq (Protein):NP_001008226