CNN1 Rabbit Polyclonal Antibody

• Catalog Number: orb330530
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CNN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: CNN1
• UniProt ID: P51911
• Protein Sequence: Synthetic peptide located within the following region: MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF
• NCBI: NP_001290
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti SMCC antibody, anti Sm-Calp antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissue, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: CNN1.

WB Suggested Anti-CNN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.