CNN1 Rabbit Polyclonal Antibody

SKU: orb330530

Description

Rabbit polyclonal antibody to CNN1

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNN1
• Target: CNN1
• Protein Sequence: Synthetic peptide located within the following region: MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF
• Molecular Weight: 33kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti SMCC antibody, anti Sm-Calp antibody

Lanes: 1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissue, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: CNN1.

WB Suggested Anti-CNN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

CNN1

UniProt

P51911

RefSeq (Protein):NP_001290