Cart summary

You have no items in your shopping cart.

CLU Rabbit Polyclonal Antibody (Biotin)

CLU Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2096467

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2096467
CategoryAntibodies
DescriptionCLU Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityEquine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLU
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW58kDa
UniProt IDP10909
Protein SequenceSynthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN
NCBINP_001822
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCLI, AAG4, APOJ, CLU1, CLU2, KUB1, SGP2, APO-J, SG
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.