You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325005 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CLEC4M |
Target | CLEC4M |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Porcine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CLEC4M |
Protein Sequence | Synthetic peptide located within the following region: LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV |
UniProt ID | Q9H2X3 |
MW | 44kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CD209L antibody, anti CD299 antibody, anti DC Read more... |
Note | For research use only |
NCBI | NP_055072 |
Human kidney
WB Suggested Anti-CLEC4M Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.
WB | |
Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Equine, Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |