CLEC4M Rabbit Polyclonal Antibody

• Catalog Number: orb325004
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CLEC4M
• Target: CLEC4M
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human CLEC4M
• Protein Sequence: Synthetic peptide located within the following region: MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA
• UniProt ID: Q9H2X3
• MW: 30kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CD209L antibody, anti CD299 antibody, anti DC
• Note: For research use only
• NCBI: NP_999842

WB Suggested Anti-CLEC4M Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Muscle.