You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585360 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CLEC4D |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | CLEC4D |
UniProt ID | Q8WXI8 |
Protein Sequence | Synthetic peptide located within the following region: FLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCV |
NCBI | NP_525126 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MCL, MPCL, CD368, CLEC6, CLEC-6, CLECSF8, Dectin-3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CLEC4D Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell.