Cart summary

You have no items in your shopping cart.

CLEC4D Rabbit Polyclonal Antibody (HRP)

CLEC4D Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2094785

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2094785
CategoryAntibodies
DescriptionCLEC4D Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW24kDa
UniProt IDQ8WXI8
Protein SequenceSynthetic peptide located within the following region: FLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCV
NCBINP_525126
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesMCL, MPCL, CD368, CLEC6, CLEC-6, CLECSF8, Dectin-3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.