You have no items in your shopping cart.
Clathrin HC Antibody
Description
Images & Validation
−| Tested Applications | IF, WB |
|---|---|
| Dilution range | WB:1:250-1:1,000, IF:1:25-1:250 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 50 aa to N-terminus of human CLTC produced in E. coli.. Antigen Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVII |
| Target | Clathrin, heavy chain (Hc) |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Clathrin heavy chain Rabbit Polyclonal Antibody [orb100509]
ICC, WB
Bovine, Canine, Frog, Insect, Invertebrate, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of At-T20 cell line lysate using Clathrin HC antibody.

Confocal immunofluoroscence analysis of Hepa1-6 cells using Clathrin HC antibody.
Quick Database Links
Documents Download
Request a Document
Protocol Information
Clathrin HC Antibody (orb180469)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











