Clathrin HC Antibody

SKU: orb180469

Description

Goat polyclonal to Clathrin Heavy Chain. Clathrin is formed by three clathrin heavy chains and three light chains. This protein is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in endocytosis of a variety of macromolecules and in the intracellular trafficking of receptors.

Images & Validation

• Tested Applications: IF, WB
• Dilution Range: WB:1:250-1:1,000, IF:1:25-1:250
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 50 aa to N-terminus of human CLTC produced in E. coli. Antigen Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVII
• Target: Clathrin, heavy chain (Hc)
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

clathrin, clathrin heavy chain 1, clathrin heavy polypeptide (Hc), clathrin heavy polypeptide-like 2, CLTC, CHC17, CLH-17, CLTCL2, Hc, heavy chain (Hc) antibody.

Quick Database Links

Gene Symbol

Clathrin, heavy chain (Hc)