Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

Clathrin HC Antibody

SKU: orb180469

Description

Goat polyclonal to Clathrin Heavy Chain. Clathrin is formed by three clathrin heavy chains and three light chains. This protein is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in endocytosis of a variety of macromolecules and in the intracellular trafficking of receptors.

Images & Validation

Tested ApplicationsIF, WB
Dilution RangeWB:1:250-1:1,000, IF:1:25-1:250
ReactivityBovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 50 aa to N-terminus of human CLTC produced in E. coli. Antigen Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVII
TargetClathrin, heavy chain (Hc)
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

clathrin, clathrin heavy chain 1, clathrin heavy polypeptide (Hc), clathrin heavy polypeptide-like 2, CLTC, CHC17, CLH-17, CLTCL2, Hc, heavy chain (Hc) antibody.

Similar Products

  • Clathrin heavy chain/CLTC Rabbit Polyclonal Antibody [orb669075]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Clathrin heavy chain/CLTC Mouse Monoclonal Antibody [orb738492]

    FC,  IHC,  WB

    Human, Mouse, Rat

    Mouse

    Monoclonal

    Unconjugated

    100 μg
  • CLTC Antibody [orb523988]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CLTC Antibody [orb523989]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Clathrin heavy chain Rabbit Polyclonal Antibody [orb100509]

    ICC,  WB

    Bovine, Canine, Frog, Insect, Invertebrate, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Clathrin HC Antibody

Western blot analysis of At-T20 cell line lysate using Clathrin HC antibody.

Clathrin HC Antibody

Confocal immunofluoroscence analysis of Hepa1-6 cells using Clathrin HC antibody.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IF
Immunofluorescence
View Protocol

Clathrin HC Antibody (orb180469)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 300.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry