You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582037 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CHMP4B |
Target | CHMP4B |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B |
Protein Sequence | Synthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP |
UniProt ID | Q9H444 |
MW | 25kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SNF7, CTPP3, Shax1, CHMP4A, SNF7-2, VPS32B, CTRCT3 Read more... |
Note | For research use only |
NCBI | NP_789782 |
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 0.5 ug/ml.
Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.
Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
Rabbit Anti-CHMP4B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-CHMP4B Antibody Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Mouse, Other, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |