CHMP4B Rabbit Polyclonal Antibody

• Catalog Number: orb582036
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHMP4B
• Target: CHMP4B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B
• Protein Sequence: Synthetic peptide located within the following region: RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
• UniProt ID: Q9H444
• MW: 25kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SNF7, CTPP3, Shax1, CHMP4A, SNF7-2, VPS32B, CTRCT3
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_789782

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-CHMP4B Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.