CHGA Rabbit Polyclonal Antibody

• Catalog Number: orb330214
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHGA
• Target: CHGA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CHGA
• Protein Sequence: Synthetic peptide located within the following region: DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
• UniProt ID: P10645
• MW: 51 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CGA antibody
• Note: For research use only
• NCBI: NP_001266

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at ~106 kDa and at ~77 kDa.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-CHGA Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.