CHFR Rabbit Polyclonal Antibody

• Catalog Number: orb330291
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHFR
• Target: CHFR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHFR
• Protein Sequence: Synthetic peptide located within the following region: REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN
• UniProt ID: Q96EP1
• MW: 69kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ10796 antibody, anti FLJ33629 antibody, an
• Research Area: Epigenetics & Chromatin, Molecular Biology, Signal
• Note: For research use only
• NCBI: NP_060693

Breast

Positive control (+): Human Lung Tumor (T-LU), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/mL.

WB Suggested Anti-CHFR Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, CHFR is supported by BioGPS gene expression data to be expressed in HepG2.