Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CHEK1 Rabbit Polyclonal Antibody

SKU: orb574279

Description

Rabbit polyclonal antibody to CHEK1

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CHEK1
TargetCHEK1
Protein SequenceSynthetic peptide located within the following region: SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
Molecular Weight54kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CHK1

Similar Products

  • CHK1 Rabbit Polyclonal Antibody [orb10381]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Chk1 (phospho Ser301) rabbit pAb Antibody [orb767470]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Chk1 (phospho Ser286) rabbit pAb Antibody [orb767469]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Chk1 (phospho Ser280) rabbit pAb Antibody [orb767466]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • CHEK1 Rabbit Polyclonal Antibody [orb574280]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CHEK1 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. CHEK1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

CHEK1 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

CHEK1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

CHEK1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

CHEK1 Rabbit Polyclonal Antibody

Lane 1: 40 ug SH-SY5Y lysate, Lane 2: 40 ug SH-SY5Y lysate, Lane 3: 40 ug HEK293T lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:8000, Gene Name: CHEK1.

CHEK1 Rabbit Polyclonal Antibody

Rabbit Anti-CHEK1 antibody, Catalog Number: orb574279, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

CHEK1 Rabbit Polyclonal Antibody

WB Suggested Anti-CHEK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001265

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CHEK1 Rabbit Polyclonal Antibody (orb574279)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry