CHEK1 Rabbit Polyclonal Antibody

• Catalog Number: orb574279
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHEK1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHEK1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: CHEK1
• UniProt ID: O14757
• Protein Sequence: Synthetic peptide located within the following region: SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
• NCBI: NP_001265
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CHK1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. CHEK1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Lane 1: 40 ug SH-SY5Y lysate, Lane 2: 40 ug SH-SY5Y lysate, Lane 3: 40 ug HEK293T lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:8000, Gene Name: CHEK1.

Rabbit Anti-CHEK1 antibody, Catalog Number: orb574279, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CHEK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.