You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578544 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CHAC1 |
Target | CHAC1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CHAC1 |
Protein Sequence | Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD |
UniProt ID | Q9BUX1 |
MW | 24 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MGC4504 |
Note | For research use only |
NCBI | NP_077016 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in 24 kDa canonical isoform as well as 29 kDa isoform and a 19 kDa isoform. Higher molecular weight bands may indicate enzymatic intermediates involving the full length protein.
Sample Tissue: Human Du145 Whole Cell, Antibody Dilution: 5 ug/ml.
Sample Tissue: Human H69 Whole Cell, Antibody Dilution: 5 ug/ml.
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/ml.
WB Suggested Anti-CHAC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. CHAC1 is supported by BioGPS gene expression data to be expressed in 721_B.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
BF488 |