CHAC1 Rabbit Polyclonal Antibody

• Catalog Number: orb578544
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHAC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CHAC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24 kDa
• Target: CHAC1
• UniProt ID: Q9BUX1
• Protein Sequence: Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
• NCBI: NP_077016
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MGC4504
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in 24 kDa canonical isoform as well as 29 kDa isoform and a 19 kDa isoform. Higher molecular weight bands may indicate enzymatic intermediates involving the full length protein.

Sample Tissue: Human Du145 Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Tissue: Human H69 Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/ml.

WB Suggested Anti-CHAC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. CHAC1 is supported by BioGPS gene expression data to be expressed in 721_B.