You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584602 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CFD |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CFD |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 27kDa |
Target | CFD |
UniProt ID | P00746 |
Protein Sequence | Synthetic peptide located within the following region: GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG |
NCBI | NP_001919 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DF, ADN, PFD, ADIPSIN Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human U937, Antibody dilution: 1.0 ug/ml.
Positive control (+): HepG2 (HG), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.
WB Suggested Anti-CFD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
BF488 |
FC, ICC, IF | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
PE |