CFC1 Rabbit Polyclonal Antibody

• Catalog Number: orb585929
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CFC1
• Target: CFC1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: IINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGW
• UniProt ID: P0CG37
• MW: 25kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HTX2, CFC1B, DTGA2, CRYPTIC
• Note: For research use only
• NCBI: NP_115934

WB Suggested Anti-CFC1 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.