CEP135 Rabbit Polyclonal Antibody

• Catalog Number: orb586304
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CEP135
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP135
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 133kDa
• Target: CEP135
• UniProt ID: Q66GS9
• Protein Sequence: Synthetic peptide located within the following region: REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI
• NCBI: NP_079285
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CEP4, MCPH8, KIAA0635
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-CEP135 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell.