You have no items in your shopping cart.
Cart summary
Cdk5r1 Peptide - C-terminal region
Catalog Number: orb2011276
| Catalog Number | orb2011276 |
|---|---|
| Category | Proteins |
| Description | Cdk5r1 Peptide - C-terminal region |
| Predicted Reactivity | Human, Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | EAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLG |
| UniProt ID | P61809 |
| MW | 34kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with Cdk5r1 Rabbit Polyclonal Antibody (orb573600). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | Cdk5r, D11Bwg0379e, p25, p35 |
| Note | For research use only |
| NCBI | NP_034001 |
