CDH1 Antibody

SKU: orb334973

Description

Goat polyclonal to CDH1. CDH1 is a classical member of the cadherin superfamily. This protein is a calcium dependent cell-cell adhesion glycoprotein comprised consists of 5 cadherin repeats in the extracellular domain, one trans membrane domain, and a and a highly conserved intracellular domain that binds b-catenin and p120-catenin. CDH1 is involved in mechanisms regulating proliferation, mobility and cell-cell adhesions of epithelial cells. Loss of E-cadherin function or expression has been implicated in cancer metastasis and progression.

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution range: WB:1:500-1:2,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli.. Antigen Sequence: FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPV
• Target: E-Cadherin
• Purification: Epitope affinity purified

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

ARC-1, CAM 120/80, CD324, CDH1, cdhc-A, CDHE, ECAD, E-Cad E-cadherin, Epithelial cadherin, l-cam, LCAM, P09803, P12830 / Q9R0T4, UVO, Uvomorulin, XBcad, XB-cadherin, XTCAD-1 antibody.

Western blot analysis of staining of HeLa lysate using CDH1 antibody

Quick Database Links

Gene Symbol

E-Cadherin