You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583936 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CDCA5 |
Target | CDCA5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CDCA5 |
Protein Sequence | Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST |
UniProt ID | Q96FF9 |
MW | 28kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SORORIN |
Note | For research use only |
NCBI | NP_542399 |
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-CDCA5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Mouse, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5.5 |
IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
AP |