CDCA5 Rabbit Polyclonal Antibody

• Catalog Number: orb583935
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDCA5
• Target: CDCA5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDCA5
• Protein Sequence: Synthetic peptide located within the following region: RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP
• UniProt ID: Q96FF9
• MW: 28kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SORORIN
• Note: For research use only
• NCBI: NP_542399

WB Suggested Anti-CDCA5 Antibody Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.