You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578377 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CD8B |
Target | CD8B |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CD8B |
Protein Sequence | Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
UniProt ID | P10966 |
MW | 21kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | LY3, P37, LEU2, LYT3, CD8B1 |
Note | For research use only |
NCBI | NP_004922 |
WB Suggested Anti-CD8B Antibody Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
IF, IHC-Fr, IHC-P | |
Equine, Gallus, Guinea pig, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Guinea pig, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |