You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585498 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CD86 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Porcine |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 23kDa |
Target | CD86 |
UniProt ID | E9PC27 |
Protein Sequence | Synthetic peptide located within the following region: WKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKT |
NCBI | NP_787058 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | B70, B7-2, B7.2, LAB72, CD28LG2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-CD86 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
PLA, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
APC |